PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01353.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CO-like
Protein Properties Length: 630aa    MW: 68743.2 Da    PI: 6.6681
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01353.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.71e-07208249338
                      zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38 
                                   +r C+ + + +++++C  ++ +lC+ C ++ H+       H+
  Zmw_sc01353.1.g00010.1.am.mk 208 ARACDGCLRRRARWYCAADDAFLCQGCDTSVHSAnplarrHE 249
                                   578*****************************6567777776 PP

2CCT67.14.8e-23575618144
                           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                   Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+a
  Zmw_sc01353.1.g00010.1.am.mk 575 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 618
                                   9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.2E-11206253IPR000315B-box-type zinc finger
PROSITE profilePS5011910.48206253IPR000315B-box-type zinc finger
CDDcd000211.18E-8209253No hitNo description
PfamPF006432.1E-6209250IPR000315B-box-type zinc finger
PfamPF062031.2E-17575617IPR010402CCT domain
PROSITE profilePS5101716.083575617IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0016020Cellular Componentmembrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MFPTEPIDSK QQGWEHADHA PFSLVLDHAG SGPRPRVPVY RYGIVASNYA CAPIDGDPGS  60
VTRAVVLLHK RRDCFRAHAR QLPAPSHHQF AHTAAAIIMS FIVDKTTTTM DGREPQWRNE  120
RKFLVLSGRT KAAHSNRDRG RERRRKGSGC RLAQWSGPPE IPSQPMAGAL AGWSVQETSP  180
ASKIVALRRQ EMITTSSSAM AAVGSKAARA CDGCLRRRAR WYCAADDAFL CQGCDTSVHS  240
ANPLARRHER LRLQQSSSPM QSPPAAGGAA KQCERRDEVV PAWFRRKART PRGGHAVAKR  300
LIVPEAAGGG NSSEGRSCVG EVEAEEEEEQ LLYRVPVFDP ALAEFCLPPP LEDTAAAASS  360
CCNADGDVVN STKPDAAPPP QPPTTTQFFP DGCAGFEPTD AELREFAADM EALLGRGLDD  420
GNEEDPFYME TLGLLDPVVD DGAKVKVENE VGGAYEAIDE LACRLDVEPE ASDEMLDIDF  480
DYGSPQETPE EKAASSDGTG SDAKFLQRSF SLTLNYEAII ESWESSPWTG GGCRPHVKLD  540
DCWPHDYSGM WVMGGVVGHG GEELSLPRLG MDGGREARVS RYREKRRTRL FSKKIRYEVR  600
KLNAEKRPRM KGRFVKRATA GGSVAIAGLA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1585601RRTRLFSKKIRYEVRKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965182.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16-like
TrEMBLA0A0A9S1W60.0A0A0A9S1W6_ARUDO; Uncharacterized protein
STRINGSi006432m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32833058